PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo2G0110500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 330aa    MW: 36932.2 Da    PI: 6.236
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo2G0110500genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.55.4e-171462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+ eEd +l+ +++q+G+g +W t ++++g++R++k+c++rw++yl
   Spipo2G0110500 14 KGPWSSEEDAKLKSYIEQHGTGgNWITLPQKIGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding383.7e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd ++  +    G++ W+ Ia+ ++ gRt++++k++w++
   Spipo2G0110500  69 GGFSEEEDNIICSLYMSIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.9962IPR017930Myb domain
SuperFamilySSF466891.17E-2611109IPR009057Homeodomain-like
SMARTSM007175.6E-121364IPR001005SANT/Myb domain
PfamPF002496.0E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-241569IPR009057Homeodomain-like
CDDcd001674.17E-91662No hitNo description
PROSITE profilePS5129421.17463117IPR017930Myb domain
SMARTSM007173.1E-1167115IPR001005SANT/Myb domain
PfamPF002494.6E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-2370117IPR009057Homeodomain-like
CDDcd001672.54E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSSE EDAKLKSYIE QHGTGGNWIT LPQKIGLKRC GKSCRLRWLN  60
YLRPNIKHGG FSEEEDNIIC SLYMSIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLLGK  120
PRKDHQNGRR PPGCLNQEAR IIQNENFSGP TNNGTCQTPY WPELPVHFYS DHDHQGSDDH  180
SSVRKFVIKL SARFSNEDTV IVQNPLGVTY STPHVYDELQ DLIDPSALAY SFTDNSSSLE  240
GLVLQGTSDC YFNPELDEML CSSLTEIEGM DRFYGVGCVS SEGSGISSSE NSSRDQISPL  300
VYAAVVSKYQ EIQPTQQCLT DEQVHFGTY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-25141177108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00089SELEXTransfer from AT3G49690Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008798899.11e-119PREDICTED: myb-related protein Myb4-like
TrEMBLB9HFU01e-105B9HFU0_POPTR; Uncharacterized protein
STRINGPOPTR_0007s14630.11e-105(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49690.11e-77myb domain protein 84